Something off about this job? Misleading? Not 100% remote?

Contra logo

Content Marketer

Contra
Contract
Mid-level
$1,500 - $2,000
Posted May 5, 2025
13 days left to apply

About the Role

What We’re Looking For:

We’re seeking a talented content marketer or UX writer who can craft thoughtful and engaging content that confidently positions our solution, while being mindful of the sensitive context of civilian defense technology. Experience in writing for technical, defense, or socially sensitive sectors would be a big plus.

Deliverables May Include:

  • Messaging and structure for pitch decks (design not included)
  • UX writing for landing pages and other digital materials
  • One-pagers that highlight key benefits and features
  • Use-case scenarios that demonstrate practical applications
  • Benefit statements that clearly communicate the problem/solution narrative

Additional Notes:

  • Clear, persuasive storytelling is a must
  • Ability to simplify technical ideas in a way that resonates with investors and customers
  • Flexibility to adjust tone depending on the audience (investor vs. end-user)

If you’re excited about working on a meaningful project and comfortable navigating this domain, we’d love to hear from you!

Required Skills

Content MarketingUX WritingTechnical WritingCopywritingStorytelling

Tags

content marketingux writingtechnical writingcopywritingmarketingdefensecivilianstorytellingpitch deckslanding pages